PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2350s0018.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 277aa    MW: 31238.8 Da    PI: 6.5079
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2350s0018.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.15e-18188221134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          Cs+Cgt +Tp+WR gp g+ktLCnaCG+++++ +
  Cagra.2350s0018.1.p 188 CSHCGTNNTPQWRTGPLGPKTLCNACGVRFKSGR 221
                          *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169927.9E-856274IPR016679Transcription factor, GATA, plant
SMARTSM004013.4E-15182232IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.05E-14185245No hitNo description
PROSITE profilePS5011411.912186218IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.6E-14186219IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.80E-14187244No hitNo description
PROSITE patternPS003440188213IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15188222IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MELWTEARAL KASLRGESTT SLKHHQVIVS EDLSRTSSLP EDFSVECFLD FSEGQLKEEE  60
EEELVSLSSS QEEQEQERDC CIFSSQPCTF DQLPSLPDED VEELEWVSRV VDDCSSPEVS  120
LLFTQTHKTK PSFSSRIPVK PRTKRSRNSL TGGRVWPLVS TNHQQQHAAT EKWRKKKQET  180
AVVFQRRCSH CGTNNTPQWR TGPLGPKTLC NACGVRFKSG RLCPEYRPAD SPTFSNEIHS  240
NLHRKVLELR KSKELGEETG EASTNQTRSN LAASGR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3171630.0AK317163.1 Arabidopsis thaliana AT4G34680 mRNA, complete cds, clone: RAFL21-96-H07.
GenBankY136500.0Y13650.1 Arabidopsis thaliana mRNA for GATA transcription factor 3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284292.10.0hypothetical protein CARUB_v10005463mg
RefseqXP_006284293.10.0hypothetical protein CARUB_v10005463mg
RefseqXP_006284294.10.0hypothetical protein CARUB_v10005463mg
SwissprotQ8L4M61e-161GATA3_ARATH; GATA transcription factor 3
TrEMBLR0GXZ40.0R0GXZ4_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__620__AT4G34680.21e-163(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57392647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34680.21e-157GATA transcription factor 3